Loading...
Statistics
Melonella.com
Melonella.com is hosted in
Ireland
/
Dublin
.
Melonella.com doesn't use HTTPS protocol.
Number of used technologies:
1.
First technologies:
Html,
Number of used javascripts: 0.
Number of used analytics tools:
0.
Its server type is:
Apache/2.2.22 (Ubuntu).
Technologies in use by Melonella.com
Technology
Number of occurences: 1
- Html
Advertisement
Server Type
- Apache/2.2.22 (Ubuntu)
Conversion rate optimization |
|
|---|---|
Clickable call number
|
Not founded! |
|
Conversion form (contact form, subcriber)
|
Not founded! |
|
Clickable email
|
Not founded! |
|
CTA (call to action) button
|
Not founded! |
|
List
|
Not founded! |
|
Image
|
Not founded! |
|
Enhancement
|
Not founded! |
|
Responsive website
|
Not founded! |
|
Facebook sharing
|
Not founded! |
|
Google+ sharing
|
Not founded! |
|
Twitter sharing
|
Not founded! |
|
Linkedin sharing
|
Not founded! |
|
Blog on the webiste
|
Not founded! |
HTTPS (SSL) - Melonella.com
Missing HTTPS protocol.
Number of occurences: 0
Server / Hosting
- IP: 46.137.111.230
- Latitude: 53.34
- Longitude: -6.26
- Country: Ireland
- City: Dublin
Rname
- ns1.server263.com
- ns1.server260.com
- melomail.melonella.com
Target
- hostmaster.melonella.com
HTTP Header Response
HTTP/1.1 200 OK
Date: Fri, 12 Aug 2016 05:29:48 GMT
Server: Apache/2.2.22 (Ubuntu)
Last-Modified: Fri, 13 May 2011 15:10:19 GMT
ETag: "41af-31-4a329b431ecc0"
Accept-Ranges: bytes
Content-Length: 49
Vary: Accept-Encoding
Content-Type: text/html
X-Cache: MISS from s_fl343
X-Cache-Lookup: MISS from s_fl343:80
Via: 1.1 s_fl343 (squid/3.5.9)
Connection: keep-alive
DNS
host: melonella.com
- class: IN
- ttl: 1800
- type: A
- ip: 77.70.78.37
host: melonella.com
- class: IN
- ttl: 25920
- type: NS
- target: ns1.server263.com
host: melonella.com
- class: IN
- ttl: 25920
- type: NS
- target: ns1.server260.com
host: melonella.com
- class: IN
- ttl: 2560
- type: SOA
- mname: ns1.server260.com
- rname: hostmaster.melonella.com
- serial: 1470849031
- refresh: 16384
- retry: 2048
- expire: 1048576
- minimum-ttl: 2560
host: melonella.com
- class: IN
- ttl: 1800
- type: MX
- pri: 0
- target: melomail.melonella.com
Common Typos/Mistakes
This list shows You some spelling mistakes at internet search for this domain.
www.elonella.com, www.mpelonella.com, www.pelonella.com, www.moelonella.com, www.oelonella.com, www.mielonella.com, www.ielonella.com, www.mkelonella.com, www.kelonella.com, www.m.elonella.com, www..elonella.com, www.muelonella.com, www.uelonella.com, www.mjelonella.com, www.jelonella.com, www.mnelonella.com, www.nelonella.com, www.m-elonella.com, www.-elonella.com, www.mlonella.com, www.mexlonella.com, www.mxlonella.com, www.meslonella.com, www.mslonella.com, www.mewlonella.com, www.mwlonella.com, www.merlonella.com, www.mrlonella.com, www.meflonella.com, www.mflonella.com, www.mevlonella.com, www.mvlonella.com, www.meclonella.com, www.mclonella.com, www.meqlonella.com, www.mqlonella.com, www.mealonella.com, www.malonella.com, www.meylonella.com, www.mylonella.com, www.meonella.com, www.meluonella.com, www.meuonella.com, www.mel8onella.com, www.me8onella.com, www.mel9onella.com, www.me9onella.com, www.meljonella.com, www.mejonella.com, www.mel0onella.com, www.me0onella.com, www.melmonella.com, www.memonella.com, www.melponella.com, www.meponella.com, www.meloonella.com, www.meoonella.com, www.melnella.com, www.melobnella.com, www.melbnella.com, www.melohnella.com, www.melhnella.com, www.melognella.com, www.melgnella.com, www.melojnella.com, www.meljnella.com, www.melomnella.com, www.melmnella.com, www.melo nella.com, www.mel nella.com, www.melovnella.com, www.melvnella.com, www.meloella.com, www.melonnella.com, www.melonella.com, www.melonhella.com, www.melohella.com, www.melonjella.com, www.melojella.com, www.melonkella.com, www.melokella.com, www.melonlella.com, www.melolella.com, www.melon ella.com, www.melo ella.com, www.melonlla.com, www.melonexlla.com, www.melonxlla.com, www.meloneslla.com, www.melonslla.com, www.melonewlla.com, www.melonwlla.com, www.melonerlla.com, www.melonrlla.com, www.meloneflla.com, www.melonflla.com, www.melonevlla.com, www.melonvlla.com, www.meloneclla.com, www.melonclla.com, www.meloneqlla.com, www.melonqlla.com, www.melonealla.com, www.melonalla.com, www.meloneylla.com, www.melonylla.com, www.melonela.com, www.melonelula.com, www.meloneula.com, www.melonel8la.com, www.melone8la.com, www.melonel9la.com, www.melone9la.com, www.meloneljla.com, www.melonejla.com, www.melonel0la.com, www.melone0la.com, www.melonelmla.com, www.melonemla.com, www.melonelpla.com, www.melonepla.com, www.melonelola.com, www.meloneola.com, www.melonela.com, www.melonellua.com, www.melonelua.com, www.melonell8a.com, www.melonel8a.com, www.melonell9a.com, www.melonel9a.com, www.melonellja.com, www.melonelja.com, www.melonell0a.com, www.melonel0a.com, www.melonellma.com, www.melonelma.com, www.melonellpa.com, www.melonelpa.com, www.melonelloa.com, www.meloneloa.com, www.melonell.com, www.melonellao.com, www.melonello.com, www.melonellap.com, www.melonellp.com, www.melonella9.com, www.melonell9.com, www.melonella.com, www.melonell.com, www.melonellai.com, www.melonelli.com, www.melonellau.com, www.melonellu.com,
Other websites we recently analyzed
- Klettertreff.org
HerzfondAustria - 84.116.32.65
Server software: Apache
Technology: Html
Number of meta tags: 4 - kasimpasalikemalefendivakfi.info | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
Cyprus - 93.89.226.17
Server software: Microsoft-IIS/7.5
Technology: CSS, Html - www.aarhusdesignbureau.dk
Denmark - 77.66.85.131
Server software: Apache-Coyote/1.1
Technology: Html
Number of meta tags: 1 - CNC-Bertschinger AG - Präzisionsmechanik
Jules Bertschinger AG, Präzisionsmechanik, CNC-Bearbeitung, Werkzeug- und FormenbauSwitzerland - 217.196.177.100
Server software: nginx
Technology: Html, Javascript, jQuery UI, Php, Xoops
Number of Javascript: 9
Number of meta tags: 8 - Riverside Haj
Riverside HajSan Francisco (United States) - 192.241.212.155
G Analytics ID: UA-51322866-1
Server software: nginx/1.4.6 (Ubuntu)
Technology: Carousel, CSS, Html, Html5, Iframe, Javascript, jQuery, Google Analytics
Number of Javascript: 13
Number of meta tags: 5 - www.newrf.ru/ - Ð¡ÐµÑ€Ð²Ð¸Ñ Ñ€ÐµÐ³Ð¸Ñтрации доменов и хоÑтинга *.RU-TLD.RU
France - 37.187.83.72
Server software: nginx
Technology: CSS, Google Font API, Html, Javascript, Shortcodes, Yandex.Metrika, Wordpress
Number of Javascript: 1
Number of meta tags: 1 - Campus-Management von CampusCore
Germany - 217.194.229.17
Server software: Apache/2.2.0 (Fedora)
Technology: Carousel, CSS, Google Font API, Html, Html5, jQuery Cycle
Number of Javascript: 10
Number of meta tags: 1 - Liikelahjat | mainoslahjat | mainostekstiilit | - Matin Sakki
Liikelahjat,mainoslahjat sekä mainostekstiilit 30 vuoden kokemuksella. Tehtävämme on auttaa sinua rakentamaan kestäviä asiakassuhteita.Finland - 84.34.147.48
Server software: Apache/2
Technology: CSS, Google Font API, Html, Javascript, Php, Google Analytics, Prestashop
Number of Javascript: 25
Number of meta tags: 7 - Park iwestycyjny kopytkowo
Park Inwestycyjny Kopytkowo to tereny inwestycyjne położone w gminie Smętowo Graniczne, w powiecie starogardzkim, w województwie pomorskim, przy węźle autostradowym Kopytkowo autostrady A1Poland - 89.161.129.57
Server software: IdeaWebServer/v0.80
Technology: CSS, Html, Html5, Javascript, SVG
Number of Javascript: 4
Number of meta tags: 4 - MDU Dev
France - 62.4.19.110
Server software: nginx
Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
Number of Javascript: 3
Number of meta tags: 3